CRISPR/Cas9 Gene Editing Kits: Unlocking the Genome Gene Editing Kits for CRISPR/Cas9: An Effective Research and Medical ToolWith the advent of potent g … read more 25th Mar 2024
Workstations and equippement AGTC offers extra discount on new lab installationsThrough our Partnets, Biodas, Gentaur, Genprice a … read more 9th May 2022 Lieven Gevaert
AGTC Product range Ask a quotation for bulk reagentsAGTC has the best rates for UK and export for the following instrum … read more 14th Apr 2022 Maria Yordanova, Genprice Inc.
Description Additional Information Description SLC7A10 Antibody | 292-ASC-112AP Expression system: Yeast Purity: > 90% SDS-PAGE Suitable for: SDS-PAGE Product name Recombinant Mouse SLC7A10 protein (Tagged) Purity > 90 % SDS-PAGE. Expression system Yeast Accession P63115 Protein length Protein fragment Animal free No Nature Recombinant Species Mouse Sequence WRSKPKCVHRFTESMTRWGQELCFVVYPQGSLEEEENGPMGQPSPLPITD KPLKTQ Amino acids 475 to 530 Additional sequence information N-terminal 6xHis-sumostar-tagged View AllClose Additional Information Size: 100 µg View AllClose
Add to Cart Quick view TK Antibody | Gentaur Gentaur MSRP: Now: €340.00 Was: TK Antibody | 399-CSB-PA234835
