HPLC Chromatography: Principle, Types, and Applications HPLC Chromatography: Principle, Types, and Applications Introduction to HPLC Chromatography HPLC Chr … read more 8th Apr 2026
Advances in Peptide Synthesis Technologies and Their Applications in Modern Biotechnology Advances in Peptide Synthesis Technologies and Their Applications in Modern Biotechnology … read more 27th Mar 2026 Hadil Sbei , Gentaur
Western Blot Introduction Western blotting is a fundamental analytical technique widely used in molecular biology … read more 27th Mar 2026 Hadil Sbei , Gentaur
Description Additional Information Description SLC7A10 Antibody | 292-ASC-112AP Expression system: Yeast Purity: > 90% SDS-PAGE Suitable for: SDS-PAGE Product name Recombinant Mouse SLC7A10 protein (Tagged) Purity > 90 % SDS-PAGE. Expression system Yeast Accession P63115 Protein length Protein fragment Animal free No Nature Recombinant Species Mouse Sequence WRSKPKCVHRFTESMTRWGQELCFVVYPQGSLEEEENGPMGQPSPLPITD KPLKTQ Amino acids 475 to 530 Additional sequence information N-terminal 6xHis-sumostar-tagged View AllClose Additional Information Size: 100 µg View AllClose
Add to Cart Quick view TK Antibody | Gentaur Gentaur MSRP: Now: €340.00 Was: TK Antibody | 399-CSB-PA234835